Research use only
Metabolic researchReference entry

Semaglutide

CATALOG NO.
SM5 / SM10 / SM20
MOL. WEIGHT
4,113.6
CLASS
Peptide
Computed conformer
Overview

Semaglutide is an acylated analogue of the 31-residue human incretin hormone GLP-1(7-37). It carries two substitutions relative to the native peptide, α-aminoisobutyric acid at position 8 and arginine at position 34, and is derivatised at lysine 26 with a C18 diacid attached through a γ-glutamate and short polyethylene-glycol linker; the Aib8 substitution blocks dipeptidyl peptidase-4 cleavage while the fatty diacid confers reversible serum-albumin binding, extending the plasma half-life from minutes to roughly seven days at the 0.5–1.0 mg doses studied. It is a prescription medicine, approved by the US Food and Drug Administration for type 2 diabetes and subsequently for chronic weight management, and has been evaluated in large phase 3 programmes in diabetes, obesity, cardiovascular disease, chronic kidney disease, steatohepatitis and Alzheimer's disease. An orally absorbed tablet formulation using a permeation enhancer was developed alongside the injectable form and carried through its own cardiovascular outcomes trial.

Research-use-only note

Information on this page is provided for laboratory research reference. The compound is not a drug, supplement, or medical product, and is not for human or veterinary use, ingestion, or consumption.

Molecular characteristics
Catalog no.SM5 / SM10 / SM20
Research areaMetabolic
ClassPeptide
SequenceH-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRG
Length31 aa
Molecular weight4,113.6 g/mol
Molecular formulaC187H291N45O59
FormLyophilized research material
AppearanceWhite to off-white powder
UseFor laboratory research use only
VerificationReference specifications pending COA verification
COA statusPending authentic product-specific COA
Measured results

No reviewed report has been published for this product family yet. The molecular values opposite are public reference data, not results measured on a CRX sample.

Browse published reports →
Sequence
HAibEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
Aib
α-Aminoisobutyric acid — Backbone-rigidifying methylated alanine; resists DPP-4 cleavage.
How it works

Semaglutide is an agonist at the GLP-1 receptor, a class B G-protein-coupled receptor that signals principally through Gs and cAMP. Its receptor affinity, 0.38 ± 0.06 nM, is threefold lower than that of liraglutide; the molecule trades receptor potency for much stronger albumin binding and full resistance to metabolic degradation, which is what makes weekly exposure possible. The established pharmacology is incretin pharmacology: glucose-dependent potentiation of insulin secretion, suppression of glucagon, and a central reduction in appetite and energy intake. Whole-brain imaging of fluorescently labelled semaglutide and c-Fos mapping in mice show that semaglutide does not cross the blood-brain barrier but reaches the brain through circumventricular organs and sites adjacent to the ventricles, engaging hindbrain, septal and hypothalamic GLP-1 receptor populations and secondarily activating regions such as the lateral parabrachial nucleus that it never touches directly. Whether the cardiovascular, renal and hepatic outcomes seen in the large trials follow entirely from weight and glycaemic change, or partly from direct receptor engagement in those tissues, remains proposed rather than settled.1,2,5,6

GLP-1 receptor (GLP1R)

Primary and, as far as is known, sole molecular target. A Gs-coupled class B GPCR whose activation raises cAMP in pancreatic beta cells, driving glucose-dependent insulin release and suppressing glucagon. Semaglutide binds it at 0.38 nM affinity.1,5

Hindbrain and hypothalamic GLP-1 receptor populations

Site of the appetite effect. In mice semaglutide reaches the brainstem, septal nucleus and hypothalamus via circumventricular organs without crossing the blood-brain barrier, and induces c-Fos activity in ten brain areas including regions with no direct drug access.6

Serum albumin

Not a signalling target but the pharmacokinetic mechanism. The C18 diacid side chain binds albumin reversibly, shielding the peptide from renal clearance and proteolysis and giving a half-life of 46.1 h in mini-pigs and approximately 7 days in humans.1,2

What the research shows12 findings · 24 sources · 11 from clinical trials

Fat loss & metabolism

In a 68-week double-blind trial in 1961 adults with obesity or overweight without diabetes (STEP 1), mean body weight changed by −14.9% in the semaglutide 2.4 mg group versus −2.4% with placebo (−15.3 kg versus −2.6 kg), and 50.5% versus 4.9% of participants lost at least 15% of baseline weight.7

Clinical trial1961 participants · 68 weeksadults with BMI ≥30, or ≥27 with a weight-related condition, and no diabetes

In an event-driven trial in 17,604 adults aged 45 or older with established cardiovascular disease and BMI 27 or greater but no diabetes (SELECT), the composite of cardiovascular death, non-fatal myocardial infarction or non-fatal stroke occurred in 6.5% of the semaglutide 2.4 mg group versus 8.0% on placebo over a mean 39.8 months (hazard ratio 0.80, 95% CI 0.72–0.90).8

Clinical trial17604 participants · mean 39.8 months follow-upadults with established cardiovascular disease and overweight or obesity, without diabetes

In the week-72 interim analysis of a phase 3 trial in 800 patients with biopsy-defined metabolic dysfunction-associated steatohepatitis and fibrosis stage 2 or 3 (ESSENCE), resolution of steatohepatitis without worsening fibrosis occurred in 62.9% of the semaglutide 2.4 mg group versus 34.3% on placebo, and fibrosis improved without worsening steatohepatitis in 36.8% versus 22.4%.9

Clinical trialPhase 3 · 800 participants · 72 weeks (interim of a 240-week trial)patients with biopsy-confirmed MASH and stage 2–3 fibrosis

In a randomised trial in 3533 patients with type 2 diabetes and chronic kidney disease (FLOW), major kidney disease events occurred in 331 patients assigned to semaglutide 1.0 mg versus 410 on placebo over a median 3.4 years (hazard ratio 0.76, 95% CI 0.66–0.88), and death from any cause was 20% lower (hazard ratio 0.80, 95% CI 0.67–0.95); the trial stopped early at a prespecified interim analysis.10

Clinical trial3533 participants · median 3.4 yearsadults with type 2 diabetes and albuminuric chronic kidney disease

In 3297 patients with type 2 diabetes at high cardiovascular risk followed for 104 weeks (SUSTAIN-6), the composite of cardiovascular death, non-fatal myocardial infarction or non-fatal stroke occurred in 6.6% of semaglutide-treated patients versus 8.9% on placebo (hazard ratio 0.74, 95% CI 0.58–0.95), with non-fatal stroke at 1.6% versus 2.7%.11

Clinical trial3297 participants · 104 weeksadults with type 2 diabetes, 83% with established cardiovascular or chronic kidney disease

In 529 patients with heart failure with preserved ejection fraction and obesity treated for 52 weeks (STEP-HFpEF), the Kansas City Cardiomyopathy Questionnaire clinical summary score rose 16.6 points in the semaglutide 2.4 mg group versus 8.7 points on placebo, six-minute walk distance changed 21.5 m versus 1.2 m, and C-reactive protein fell a mean 43.5% versus 7.3%.12

Clinical trial529 participants · 52 weekspatients with HFpEF and BMI ≥30

In a 72-week open-label head-to-head trial in 751 adults with obesity but without type 2 diabetes (SURMOUNT-5), weight changed by −13.7% (95% CI −14.9 to −12.6) in the semaglutide arm titrated to its maximum tolerated dose versus −20.2% (95% CI −21.4 to −19.1) with tirzepatide, and waist circumference by −13.0 cm versus −18.4 cm.13

Clinical trialPhase 3b · 751 participants · 72 weeksadults with obesity and no type 2 diabetes, open-label active-controlled

In a 68-week phase 3 trial in 407 adults with obesity and moderate knee osteoarthritis with at least moderate pain (STEP 9), the WOMAC pain score fell 41.7 points in the semaglutide 2.4 mg group versus 27.5 points on placebo, with body weight changing −13.7% versus −3.2% and SF-36 physical function improving 12.0 versus 6.5 points.14

Clinical trialPhase 3 · 407 participants · 68 weeksadults with BMI ≥30 and radiologically confirmed moderate knee osteoarthritis

In a 20-week double-blind parallel-group trial in 72 adults with obesity, ad libitum energy intake at a test lunch was 35% lower in the semaglutide 2.4 mg group than on placebo (1736 versus 2676 kJ), and the investigators found no evidence of delayed gastric emptying at week 20: the 5-hour paracetamol AUC was 8% above placebo (P = 0.005) but not after correction for body weight (P = 0.12).15

Clinical trial72 participants · 20 weeksadults with obesity, double-blind parallel-group mechanistic study

Focus & brain health

In two phase 3 trials in 3808 adults with amyloid-confirmed early symptomatic Alzheimer's disease (evoke and evoke+), oral semaglutide 14 mg did not slow progression: the change in Clinical Dementia Rating-Sum of Boxes at week 104 was 2.3 versus 2.3 with placebo in evoke (difference −0.08, 95% CI −0.35 to 0.20) and 2.2 versus 2.1 in evoke+ (0.10, 95% CI −0.17 to 0.38). Both were discontinued for negative clinical outcome.16

Clinical trialPhase 3 · 3808 participants · 104-week primary endpoint, up to 156 weeksadults aged 55–85 with amyloid-confirmed mild cognitive impairment or mild dementia due to Alzheimer's disease

In a 9-week phase 2 trial in 48 non-treatment-seeking adults with alcohol use disorder, low-dose semaglutide reduced alcohol consumed in a post-treatment laboratory self-administration task relative to placebo (β −0.48, 95% CI −0.85 to −0.11 for grams) and reduced drinks per drinking day (β −0.41, 95% CI −0.73 to −0.09), with no effect on drinks per calendar day or number of drinking days.17

Clinical trialPhase 2 · 48 participants · 9 weeksnon-treatment-seeking adults with alcohol use disorder at a single US academic medical centre

In 3xTg mice, a transgenic model of Alzheimer's disease, 30 days of alternate-day semaglutide improved learning and memory across a behavioural battery — the report does not break out which individual tests reached significance — and reduced hippocampal amyloid-β plaque and neurofibrillary tangle burden, with raised SIRT1 and GLUT4 expression; in cultured HT22 mouse hippocampal neurons the SIRT1 inhibitor EX527 abolished the effects on glycolysis and GLUT4 translocation.18

Animal study30 days3xTg transgenic mice and cultured HT22 mouse hippocampal neurons
Reported adverse events

What investigators recorded alongside the results above, at the rates their papers state.

Gastrointestinal events — nausea, diarrhoea, vomiting and constipation — typically transient and mild to moderate, concentrated during dose escalation7,19

Risk ratio 1.49 (95% CI 1.38–1.60) versus placebo pooled across six randomised trials in 3962 adults with overweight or obesity; in STEP 1, 4.5% of the semaglutide group versus 0.8% of the placebo group discontinued treatment because of gastrointestinal events

Evidence review

Permanent discontinuation of trial product for adverse events8

16.6% (1461/8803) with semaglutide 2.4 mg versus 8.2% (718/8801) with placebo over a mean 34.2 months of exposure (P<0.001)

Clinical trial

Diabetic retinopathy complications — vitreous haemorrhage, blindness, or conditions requiring intravitreal treatment or photocoagulation11

Significantly higher with semaglutide than placebo over 104 weeks: hazard ratio 1.76 (95% CI 1.11–2.78, P=0.02)

Clinical trial

Gallbladder and biliary disease, including cholelithiasis and cholecystitis (class-level signal for GLP-1 receptor agonists, not semaglutide alone)20

Relative risk 1.37 (95% CI 1.23–1.52) across 76 randomised trials in 103,371 patients; the signal was larger in the 13 weight-loss trials (RR 2.29, 95% CI 1.64–3.18) than in the 63 diabetes and other trials (RR 1.27, 95% CI 1.14–1.43), and larger at higher doses (RR 1.56) than lower (RR 0.99)

Evidence review

Pancreatitis, bowel obstruction and gastroparesis (pooled across semaglutide and liraglutide users)21

In a cohort of 5411 US patients dispensed a weight-loss drug (613 semaglutide, 4144 liraglutide, 654 bupropion-naltrexone), GLP-1 agonist use versus bupropion-naltrexone carried adjusted hazard ratios of 9.09 (95% CI 1.25–66.00) for pancreatitis, 4.22 (95% CI 1.02–17.40) for bowel obstruction and 3.67 (95% CI 1.15–11.90) for gastroparesis; biliary disease was not significantly raised (1.50, 95% CI 0.89–2.53). Absolute rates were low, and the confidence intervals are very wide

Reference data

Non-arteritic anterior ischaemic optic neuropathy (NAION)22

In a propensity-matched single-centre neuro-ophthalmology registry, 36-month cumulative incidence was 8.9% versus 1.8% among patients with type 2 diabetes (hazard ratio 4.28, 95% CI 1.62–11.29) and 6.7% versus 0.8% among patients who were overweight or obese (hazard ratio 7.64, 95% CI 2.21–26.36). The absolute event counts were small (17 and 20 events) and the cohort was drawn from patients already referred to neuro-ophthalmology, so the design cannot establish causality

Reference data

Cancer, including thyroid and pancreatic — no excess detected, but the analysis is underpowered for rare events23

Versus placebo, odds ratios were 2.04 (95% CI 0.33–12.61) for thyroid cancer, 0.25 (95% CI 0.03–2.24) for pancreatic cancer and 0.95 (95% CI 0.62–1.45) for all neoplasms, pooled across 37 randomised trials and 19 real-world studies covering 16,839 placebo-controlled and 13,330 real-world patients

Evidence review

Overall treatment-emergent adverse events in an older neurological population16

91.2% (1729/1896) of participants receiving oral semaglutide versus 84.8% (1613/1902) receiving placebo across evoke and evoke+; five deaths were judged treatment-related by investigators, one in the semaglutide group and four in the placebo group

Clinical trial
Sources
  1. 1.Discovery of the Once-Weekly Glucagon-Like Peptide-1 (GLP-1) Analogue Semaglutide. · J Med Chem · 2015 · PMID 26308095
  2. 2.Pharmacokinetics and Clinical Implications of Semaglutide: A New Glucagon-Like Peptide (GLP)-1 Receptor Agonist. · Clin Pharmacokinet · 2018 · PMID 29915923
  3. 3.Wegovy (semaglutide): a new weight loss drug for chronic weight management. · J Investig Med · 2022 · PMID 34706925
  4. 4.Oral Semaglutide and Cardiovascular Outcomes in Patients with Type 2 Diabetes. · N Engl J Med · 2019 · PMID 31185157
  5. 5.Mechanisms of Action and Therapeutic Application of Glucagon-like Peptide-1. · Cell Metab · 2018 · PMID 29617641
  6. 6.Semaglutide lowers body weight in rodents via distributed neural pathways. · JCI Insight · 2020 · PMID 32213703
  7. 7.Once-Weekly Semaglutide in Adults with Overweight or Obesity. · N Engl J Med · 2021 · PMID 33567185
  8. 8.Semaglutide and Cardiovascular Outcomes in Obesity without Diabetes. · N Engl J Med · 2023 · PMID 37952131
  9. 9.Phase 3 Trial of Semaglutide in Metabolic Dysfunction-Associated Steatohepatitis. · N Engl J Med · 2025 · PMID 40305708
  10. 10.Effects of Semaglutide on Chronic Kidney Disease in Patients with Type 2 Diabetes. · N Engl J Med · 2024 · PMID 38785209
  11. 11.Semaglutide and Cardiovascular Outcomes in Patients with Type 2 Diabetes. · N Engl J Med · 2016 · PMID 27633186
  12. 12.Semaglutide in Patients with Heart Failure with Preserved Ejection Fraction and Obesity. · N Engl J Med · 2023 · PMID 37622681
  13. 13.Tirzepatide as Compared with Semaglutide for the Treatment of Obesity. · N Engl J Med · 2025 · PMID 40353578
  14. 14.Once-Weekly Semaglutide in Persons with Obesity and Knee Osteoarthritis. · N Engl J Med · 2024 · PMID 39476339
  15. 15.The effect of semaglutide 2.4 mg once weekly on energy intake, appetite, control of eating, and gastric emptying in adults with obesity. · Diabetes Obes Metab · 2021 · PMID 33269530
  16. 16.Efficacy and safety of oral semaglutide 14 mg (flexible dose) in early-stage symptomatic Alzheimer's disease (evoke and evoke+): two phase 3, randomised, placebo-controlled trials. · Lancet · 2026 · PMID 41865758
  17. 17.Once-Weekly Semaglutide in Adults With Alcohol Use Disorder: A Randomized Clinical Trial. · JAMA Psychiatry · 2025 · PMID 39937469
  18. 18.Semaglutide ameliorates cognition and glucose metabolism dysfunction in the 3xTg mouse model of Alzheimer's disease via the GLP-1R/SIRT1/GLUT4 pathway. · Neuropharmacology · 2023 · PMID 37730113
  19. 19.Efficacy and safety of semaglutide 2.4 mg for weight loss in overweight or obese adults without diabetes: An updated systematic review and meta-analysis including the 2-year STEP 5 trial. · Diabetes Obes Metab · 2024 · PMID 38016699
  20. 20.Association of Glucagon-Like Peptide-1 Receptor Agonist Use With Risk of Gallbladder and Biliary Diseases: A Systematic Review and Meta-analysis of Randomized Clinical Trials. · JAMA Intern Med · 2022 · PMID 35344001
  21. 21.Risk of Gastrointestinal Adverse Events Associated With Glucagon-Like Peptide-1 Receptor Agonists for Weight Loss. · JAMA · 2023 · PMID 37796527
  22. 22.Risk of Nonarteritic Anterior Ischemic Optic Neuropathy in Patients Prescribed Semaglutide. · JAMA Ophthalmol · 2024 · PMID 38958939
  23. 23.Semaglutide and cancer: A systematic review and meta-analysis. · Diabetes Metab Syndr · 2023 · PMID 37531876
  24. 24.Coadministered Cagrilintide and Semaglutide in Adults with Overweight or Obesity. · N Engl J Med · 2025 · PMID 40544433
Public COA coverage
No reviewed public report is currently available for this product family. Molecular values above are reference information, not tested-sample results.

Verifying account access