Research use only
Signaling researchReference entry

Tesamorelin

CATALOG NO.
TSM5 / TSM10 / TSM20
MOL. WEIGHT
5,135.9
CLASS
Peptide
Computed conformer
Overview

Tesamorelin is a 44-residue synthetic analogue of human growth hormone-releasing hormone, GHRH(1-44) amide, carrying a trans-3-hexenoyl group on the N-terminal tyrosine (C221H366N72O67S, molecular weight about 5,136; PubChem CID 16137828). That single acyl modification makes the peptide resistant to cleavage by dipeptidyl peptidase-4 and slows its degradation in rat, dog and human plasma relative to native hGRF(1-44), which is what distinguishes it pharmacologically from the unmodified hormone. It is a GHRH-receptor agonist: it drives the pituitary to release its own growth hormone in pulses rather than supplying growth hormone directly. The US Food and Drug Administration approved it in 2010 under the name Egrifta for reduction of excess abdominal fat in adults with HIV-associated lipodystrophy, and it remains the only agent approved for that indication.

Research-use-only note

Information on this page is provided for laboratory research reference. The compound is not a drug, supplement, or medical product, and is not for human or veterinary use, ingestion, or consumption.

Molecular characteristics
Catalog no.TSM5 / TSM10 / TSM20
Research areaSignaling
ClassPeptide
Sequencetrans-3-hexenoyl-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Length44 aa
Molecular weight5,135.9 g/mol
Molecular formulaC221H366N72O67S
FormLyophilized research material
AppearanceWhite to off-white powder
StorageRefrigerated or frozen storage per protocol
UseFor laboratory research use only
Measured results

No reviewed report has been published for this product family yet. The molecular values opposite are public reference data, not results measured on a CRX sample.

Browse published reports →
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLNH₂
How it works

Tesamorelin binds the pituitary GHRH receptor and stimulates the synthesis and pulsatile release of endogenous growth hormone; in an uncontrolled, single-arm study of thirteen healthy men, two weeks of daily treatment raised mean overnight growth hormone by 0.5 microgram/L and basal secretion by 0.008 microgram/L per minute against each man's own baseline. Circulating IGF-1, the downstream hepatic readout of growth hormone action, is the pharmacodynamic marker used throughout the programme and rose 81.0% versus a 5.0% fall on placebo in the registrational trial. The trans-3-hexenoyl cap does not create a new target; it shields the peptide from dipeptidyl peptidase-4, so the same receptor is engaged for longer. Why the fat lost is visceral rather than subcutaneous is not established: the depot selectivity is a consistent trial observation, not a demonstrated mechanism. In the liver, paired biopsies from a 12-month randomised trial show hallmark oxidative phosphorylation gene sets upregulated and inflammation, tissue-repair and cell-division gene sets downregulated relative to placebo, which is the current mechanistic account of the hepatic findings but remains correlative.1,5,6,7

GHRH receptor (GHRHR)

Pituitary somatotroph receptor; tesamorelin is an agonist, and two weeks of daily dosing in healthy men increased both basal and pulsatile growth hormone secretion in an uncontrolled, single-arm study. Established.1,5

Dipeptidyl peptidase-4 (DPP-4)

Not an effector target but the protease that inactivates native GHRH; the trans-3-hexenoyl group on Tyr1 confers resistance and slowed in vitro degradation in rat, dog and human plasma. Established.1

Hepatic growth hormone receptor / IGF-1 axis

Downstream amplifier of the growth hormone pulse; IGF-1 rose 81.0% versus a 5.0% fall on placebo over 26 weeks and by 181 microgram/L over two weeks in healthy men. Established.5,6

Hepatic oxidative phosphorylation and immune gene programmes

In paired human liver biopsies, tesamorelin raised hallmark oxidative phosphorylation gene sets and lowered sets for inflammation, tissue repair and cell division versus placebo, alongside a fall in 13 circulating immune proteins. Proposed mediator of the liver findings, not proven causal.7,8

What the research shows12 findings · 21 sources · 10 from clinical trials

Fat loss & metabolism

In a pooled analysis of two 26-week randomised, double-blind, placebo-controlled phase 3 trials in 806 adults with HIV and excess abdominal fat, visceral adipose tissue fell by 24 +/- 41 cm2 on tesamorelin versus a 2 +/- 35 cm2 increase on placebo (P<0.001; treatment effect -15.4%), while abdominal subcutaneous fat was unchanged (-2 +/- 32 vs 2 +/- 29 cm2, P=0.08).9

Clinical trialPhase 3 · 806 participants · 26 weeksadults with HIV on antiretroviral therapy and excess abdominal fat

In the 26-week randomised, double-blind registrational trial in 412 adults with HIV and abdominal fat accumulation, visceral adipose tissue fell 15.2% on tesamorelin and rose 5.0% on placebo, triglycerides fell 50 mg/dL versus a 9 mg/dL rise, the total-cholesterol-to-HDL ratio fell 0.31 versus a 0.21 rise, and IGF-1 rose 81.0% versus a 5.0% fall (P<0.001 for all).6

Clinical trialPhase 3 · 412 participants · 26 weeksadults with HIV and abdominal fat accumulation

In a 12-month randomised, double-blind, multicentre trial in 61 people with HIV and non-alcoholic fatty liver disease, hepatic fat fraction fell by an absolute 4.1% more than placebo (95% CI -7.6 to -0.7, P=0.018), a 37% relative reduction, and 35% of tesamorelin recipients versus 4% on placebo reached a hepatic fat fraction below 5% (P=0.0069).10

Clinical trial61 participants · 12 monthspeople with HIV and non-alcoholic fatty liver disease

In the 26-week extension of a phase 3 trial that randomised 410 adults with HIV and central fat accumulation, the subgroup rerandomised to stay on tesamorelin held visceral adipose tissue 18% below baseline over 52 weeks (P<0.001 versus baseline) and triglycerides 51 mg/dL below baseline (P<0.001), while visceral fat reaccumulated in participants switched to placebo — the effect does not outlast the exposure.11

Clinical trialPhase 3 · 410 participants · 52 weeksadults with HIV and central fat accumulation

A 2026 random-effects meta-analysis of five randomised controlled trials in adults with HIV-associated lipodystrophy found tesamorelin reduced visceral adipose tissue by 27.71 cm2 (95% CI -38.37 to -17.06), hepatic fat by 4.28 percentage points (95% CI -6.31 to -2.24) and waist circumference by 1.61 cm versus placebo, and increased lean body mass by 1.42 kg (95% CI 1.13 to 1.71), with no significant change in subcutaneous adipose tissue or BMI.12

Evidence reviewmeta-analysis of five randomised controlled trials in adults with HIV-associated lipodystrophy

In a 12-month randomised, double-blind, placebo-controlled trial in 60 abdominally obese adults with reduced growth hormone secretion, tesamorelin lowered visceral adipose tissue by 35 cm2 (95% CI -58 to -12, P=0.003), carotid intima-media thickness by 0.04 mm (95% CI -0.07 to -0.01, P=0.02), log C-reactive protein (P=0.04) and triglycerides by 37 mg/dL (95% CI -67 to -7, P=0.02) relative to placebo, with no change in subcutaneous adipose tissue, fasting glucose, 2-hour glucose or glycated haemoglobin.13

Clinical trial60 participants · 12 monthsabdominally obese adults with reduced growth hormone secretion

Recovery & repair

On paired liver biopsies from a 12-month randomised, double-blind trial in 61 people with HIV and non-alcoholic fatty liver disease, fibrosis progressed at least one stage in 2 of 19 tesamorelin recipients versus 9 of 24 on placebo (10.5% vs 37.5%, P=0.04). The NAFLD activity score did not differ (effect size -0.3, 95% CI -1.0 to 0.5), and existing fibrosis did not improve (2 vs 3 participants, P=0.71).10

Clinical trial61 participants · 12 monthspaired liver biopsies in people with HIV and non-alcoholic fatty liver disease

In a secondary CT analysis of two randomised trials in adults with HIV and abdominal obesity, comparing 193 tesamorelin responders whose visceral fat fell at least 8% with 148 placebo participants, 26 weeks of treatment increased the density of four trunk muscle groups by 1.56 to 4.86 Hounsfield units and lean muscle area by 0.64 to 1.08 cm2 (all P<0.005). Restricting to responders makes this not a randomised comparison.14

Clinical trial341 participants · 26 weeksadults with HIV and abdominal obesity, tesamorelin responders vs placebo

Growth hormone

In an uncontrolled, single-arm open-label study, 13 healthy men (mean age 45 years) took tesamorelin daily for two weeks; against their own baselines, mean overnight growth hormone rose by 0.5 +/- 0.1 microgram/L (P=0.004), basal secretion by 0.008 +/- 0.003 microgram/L per minute (P=0.008) and IGF-1 by 181 +/- 22 microgram/L (P<0.0001), while insulin-stimulated glucose uptake on euglycaemic hyperinsulinaemic clamp was unchanged (P=0.61). There was no placebo group.5

Clinical trial13 participants · 2 weekshealthy men, mean age 45 years; uncontrolled single-arm

In non-clinical characterisation, adding the trans-3-hexenoyl moiety to Tyr1 of hGRF(1-44) made the peptide resistant to dipeptidyl aminopeptidase-IV and slowed its degradation in rat, dog and human plasma; in pigs, rats and dogs, repeated intravenous or subcutaneous dosing up to 600 microgram/kg markedly raised plasma growth hormone and IGF-1, with an apparent elimination half-life in dogs of 21 to 45 minutes.1

Animal studyup to 4 monthsrat, dog and pig; rat, dog and human plasma in vitro

Focus & brain health

In a 20-week randomised, double-blind, placebo-controlled trial in 152 adults aged 55 to 87, of whom 66 had mild cognitive impairment, tesamorelin produced a favourable effect on a composite cognitive outcome in intention-to-treat analysis (P=0.03); of the three pre-specified composites only executive function reached significance (P=0.005), verbal memory showed a non-significant trend (P=0.08) and no treatment effect on visual memory was reported. IGF-1 rose 117%, remaining within the physiological range, and percent body fat fell 7.4%.15

Clinical trial152 participants · 20 weeksadults aged 55-87 with mild cognitive impairment or normal cognition

In a 6-month open-label phase 2 trial in 73 virally suppressed people with HIV and abdominal obesity, tesamorelin reduced waist circumference by a median 2.7 cm more than standard of care (P=0.015), but the between-group difference in neurocognitive performance was not significant (P=0.673); the trial was underpowered and had no placebo arm.16

Clinical trialPhase 2 · 73 participants · 6 monthsvirally suppressed adults with HIV and abdominal obesity
Reported adverse events

What investigators recorded alongside the results above, at the rates their papers state.

Injection-site reactions (erythema, stinging, other local complaints)10

10 of 31 tesamorelin vs 1 of 30 placebo for other injection-site complaints; stinging 4 vs 1; erythema 3 vs 0

Clinical trial61 participants

Hyperglycaemia and an early rise in fasting glucose, without loss of control in established type 2 diabetes (three randomised trials in different populations)10,17,18

hyperglycaemia in 12 of 31 tesamorelin vs 11 of 30 placebo over 12 months in the randomised NAFLD trial, with two tesamorelin participants discontinuing for hyperglycaemia; in a separate 6-month randomised trial in 50 adults with HIV and abdominal fat accumulation, fasting glucose rose 9 mg/dL vs 2 mg/dL at 2 weeks (treatment effect 7 mg/dL, 95% CI 1-14, P=0.03) with no significant difference at 6 months (P=0.72); and in a randomised placebo-controlled trial in 53 adults with established type 2 diabetes there was no significant between-group difference in relative insulin response, fasting glucose or HbA1c over 12 weeks, and no participant discontinued for loss of diabetes control

Clinical trial61 participants

Serious adverse events2,10

fewer than 4% of patients over 26 weeks across the phase 3 programme; 4 of 31 vs 2 of 30 over 12 months in the NAFLD trial

Evidence review

Arthralgia, myalgia, paraesthesia and peripheral oedema12,19

arthralgia and oedema were statistically significant class effects across 10 placebo-controlled growth-hormone-axis trials in 1511 patients; the 2026 meta-analysis of five tesamorelin trials lists arthralgia, myalgia, paraesthesia and injection-site erythema without pooled incidence

Evidence review

Withdrawal from study because of an adverse event6

overall adverse-event rates did not differ significantly between arms, but more tesamorelin than placebo participants withdrew for an adverse event; exact counts not given in the report

Clinical trial412 participants

Reversible hepatic and renal findings, anaemia and organ-weight changes in animals1

increased body-weight gain over up to 4 months of daily dosing was seen in both rats and dogs; the drug was reported as well tolerated in both species, but reversible liver and kidney findings, anaemia, clinical chemistry changes and organ-weight effects were more evident in dogs after repeat daily subcutaneous injection and were attributed to sustained supraphysiological growth hormone and IGF-1

Animal studyup to 4 months
Sources
  1. 1.Non-clinical pharmacology and safety evaluation of TH9507, a human growth hormone-releasing factor analogue. · Basic Clin Pharmacol Toxicol · 2007 · PMID 17214611
  2. 2.Tesamorelin: a review of its use in the management of HIV-associated lipodystrophy. · Drugs · 2011 · PMID 21668043
  3. 3.FDA approves tesamorelin for HIV-related lipodystrophy. · Am J Health Syst Pharm · 2010 · PMID 21115997
  4. 4.Tesamorelin, CID 16137828 · PubChem Compound Database
  5. 5.Effects of a growth hormone-releasing hormone analog on endogenous GH pulsatility and insulin sensitivity in healthy men. · J Clin Endocrinol Metab · 2011 · PMID 20943777
  6. 6.Metabolic effects of a growth hormone-releasing factor in patients with HIV. · N Engl J Med · 2007 · PMID 18057338
  7. 7.Effects of tesamorelin on hepatic transcriptomic signatures in HIV-associated NAFLD. · JCI Insight · 2020 · PMID 32701508
  8. 8.Growth Hormone Releasing Hormone Reduces Circulating Markers of Immune Activation in Parallel with Effects on Hepatic Immune Pathways in Individuals with HIV-infection and Nonalcoholic Fatty Liver Disease. · Clin Infect Dis · 2021 · PMID 33852720
  9. 9.Effects of tesamorelin (TH9507), a growth hormone-releasing factor analog, in human immunodeficiency virus-infected patients with excess abdominal fat: a pooled analysis of two multicenter, double-blind placebo-controlled phase 3 trials with safety extension data. · J Clin Endocrinol Metab · 2010 · PMID 20554713
  10. 10.Effects of tesamorelin on non-alcoholic fatty liver disease in HIV: a randomised, double-blind, multicentre trial. · Lancet HIV · 2019 · PMID 31611038
  11. 11.Long-term safety and effects of tesamorelin, a growth hormone-releasing factor analogue, in HIV patients with abdominal fat accumulation. · AIDS · 2008 · PMID 18690162
  12. 12.Body composition, hepatic fat, metabolic, and safety outcomes of Tesamorelin, a GHRH analogue, in HIV-associated lipodystrophy: A meta-analysis of randomized controlled trials. · Obes Res Clin Pract · 2026 · PMID 41545261
  13. 13.Metabolic effects of a growth hormone-releasing factor in obese subjects with reduced growth hormone secretion: a randomized controlled trial. · J Clin Endocrinol Metab · 2012 · PMID 23015655
  14. 14.The Growth Hormone Releasing Hormone Analogue, Tesamorelin, Decreases Muscle Fat and Increases Muscle Area in Adults with HIV. · J Frailty Aging · 2019 · PMID 31237318
  15. 15.Effects of growth hormone–releasing hormone on cognitive function in adults with mild cognitive impairment and healthy older adults: results of a controlled trial. · Arch Neurol · 2012 · PMID 22869065
  16. 16.Effects of Tesamorelin on Neurocognitive Impairment in Persons With HIV and Abdominal Obesity. · J Infect Dis · 2025 · PMID 39813152
  17. 17.Effect of tesamorelin on visceral fat and liver fat in HIV-infected patients with abdominal fat accumulation: a randomized clinical trial. · JAMA · 2014 · PMID 25038357
  18. 18.Safety and metabolic effects of tesamorelin, a growth hormone-releasing factor analogue, in patients with type 2 diabetes: A randomized, placebo-controlled trial. · PLoS One · 2017 · PMID 28617838
  19. 19.Growth hormone axis treatments for HIV-associated lipodystrophy: a systematic review of placebo-controlled trials. · HIV Med · 2011 · PMID 21265979
  20. 20.Advances in the detection of growth hormone releasing hormone synthetic analogs. · Drug Test Anal · 2021 · PMID 34665524
  21. 21.Metabolic dysfunction-associated steatotic liver disease in people with HIV. · Curr Opin HIV AIDS · 2025 · PMID 40397552
Public COA coverage
No reviewed public report is currently available for this product family. Molecular values above are reference information, not tested-sample results.

Verifying account access